PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 317aa    MW: 33703.9 Da    PI: 9.4338
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00708.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.75.1e-3280133357
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                     +vrY+eClkNhAa++Gg a+DGCgEfmp+ geeg+ +al+C+ACgCHRnFHR+e+
  Pahal.C00708.1  80 GVRYRECLKNHAAAIGGSATDGCGEFMPA-GEEGSLDALRCSACGCHRNFHRKEP 133
                     69**************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.9E-2981133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2282133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.4E-3082132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.68283132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.8E-30196268IPR009057Homeodomain-like
SuperFamilySSF466892.69E-19200268IPR009057Homeodomain-like
TIGRFAMsTIGR015654.8E-27207263IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MDLSGAQGEL PVPMAMHGGG GGSPYLGLHH GHHHEHPQQH SRGPNGRHMS PPDVVVPEEA  60
KNRQLAVVPV GAVGGGGAGG VRYRECLKNH AAAIGGSATD GCGEFMPAGE EGSLDALRCS  120
ACGCHRNFHR KEPPGGDARQ LHGHHPHHHP LSPLAAAHHH HRGLLVAALP PAPTRMVMPL  180
SALQHQAHHS AASAESDDAR AQQPPARKRF RTKFTAEQKA RMLGFAEEAG WRLQKLDDAA  240
VQRFCQEVGV KRRVLKVWMH NNKHTLARRG QEGGHHGGDP EHLGQLGGGM PLPEPGGPGR  300
SPSPSRSPPP QQLRLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-252082651875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0432581e-164BT043258.1 Zea mays full-length cDNA clone ZM_BFc0135C02 mRNA, complete cds.
GenBankBT0650051e-164BT065005.1 Zea mays full-length cDNA clone ZM_BFc0120L10 mRNA, complete cds.
GenBankBT0655691e-164BT065569.1 Zea mays full-length cDNA clone ZM_BFb0298N18 mRNA, complete cds.
GenBankEU9655081e-164EU965508.1 Zea mays clone 286516 mRNA sequence.
GenBankJX4285001e-164JX428500.1 Zea mays subsp. mays clone pUT3098 ZHD21 ZF-HD type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443023.11e-152hypothetical protein SORBIDRAFT_08g006490
SwissprotQ2QW442e-80ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLC5YTM11e-152C5YTM1_SORBI; Putative uncharacterized protein Sb08g006490
STRINGSb08g006490.11e-151(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.26e-53homeobox protein 31